PDB entry 1sqr

View 1sqr on RCSB PDB site
Description: Solution Structure of the 50S Ribosomal Protein L35AE from Pyrococcus furiosus. Northeast Structural Genomics Consortium Target PfR48.
Class: ribosome
Keywords: PfR48, NMR STRUCTURE, AUTOSTRUCTURE, RIBOSOMAL PROTEIN, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, BETA-BARREL, NESG, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, RIBOSOME
Deposited on 2004-03-19, released 2004-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L35Ae
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: RPL35AE, PF1872
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sqra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqrA (A:)
    mrikgvvlsyrrskenqhnnvmiikpldvnsreeaskligrlvlwkspsgkilkgkivrv
    hgtkgavrarfekglpgqalgdyveivlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqrA (A:)
    mrikgvvlsyrrskenqhnnvmiikpldvnsreeaskligrlvlwkspsgkilkgkivrv
    hgtkgavrarfekglpgqalgdyveiv