PDB entry 1sqn

View 1sqn on RCSB PDB site
Description: progesterone receptor ligand binding domain with bound norethindrone
Deposited on 2004-03-19, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.188
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sqna_
  • Chain 'B':
    Domains in SCOP 1.69: d1sqnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqnA (A:)
    ftfspgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkw
    skslpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkes
    sfyslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirel
    ikaiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsev
    iaaqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqnA (A:)
    qlipplinllmsiepdviyaghdnpdtssslltslnqlgerqllsvvkwskslpgfrnlh
    iddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmwq
    ipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqgvv
    sssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkilagm
    vkpllfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sqnB (B:)
    ftfspgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkw
    skslpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkes
    sfyslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirel
    ikaiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsev
    iaaqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqnB (B:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqgv
    vsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkilag
    mvkpllfhkk