PDB entry 1sql

View 1sql on RCSB PDB site
Description: Crystal structure of 7,8-dihydroneopterin aldolase in complex with guanine
Deposited on 2004-03-19, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sqla_
  • Chain 'B':
    Domains in SCOP 1.69: d1sqlb_
  • Chain 'C':
    Domains in SCOP 1.69: d1sqlc_
  • Chain 'D':
    Domains in SCOP 1.69: d1sqld_
  • Chain 'E':
    Domains in SCOP 1.69: d1sqle_
  • Chain 'F':
    Domains in SCOP 1.69: d1sqlf_
  • Chain 'G':
    Domains in SCOP 1.69: d1sqlg_
  • Chain 'H':
    Domains in SCOP 1.69: d1sqlh_
  • Chain 'I':
    Domains in SCOP 1.69: d1sqli_
  • Chain 'J':
    Domains in SCOP 1.69: d1sqlj_
  • Chain 'K':
    Domains in SCOP 1.69: d1sqlk_
  • Chain 'L':
    Domains in SCOP 1.69: d1sqll_
  • Chain 'M':
    Domains in SCOP 1.69: d1sqlm_
  • Chain 'N':
    Domains in SCOP 1.69: d1sqln_
  • Chain 'O':
    Domains in SCOP 1.69: d1sqlo_
  • Chain 'P':
    Domains in SCOP 1.69: d1sqlp_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqlA (A:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlA (A:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sqlB (B:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlB (B:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    n
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sqlC (C:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlC (C:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    nt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sqlD (D:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlD (D:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sqlE (E:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlE (E:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sqlF (F:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlF (F:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    n
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1sqlG (G:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlG (G:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    n
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1sqlH (H:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlH (H:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    nt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1sqlI (I:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlI (I:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    n
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1sqlJ (J:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlJ (J:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    nts
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1sqlK (K:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlK (K:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1sqlL (L:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlL (L:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    nt
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1sqlM (M:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlM (M:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    nts
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1sqlN (N:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlN (N:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    n
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1sqlO (O:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlO (O:)
    gdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsla
    keivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrqr
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1sqlP (P:)
    mhsslettapatlerresnlgdklilkglkfygfhgaiaeertlgqmflvdidawvslkk
    agesdnledtisyvdifslakeivegsprnlletvaeliasktlekfhqinavrvklskp
    nvalikstidylgvdifrqrntsskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqlP (P:)
    lgdklilkglkfygfhgaiaeertlgqmflvdidawvslkkagesdnledtisyvdifsl
    akeivegsprnlletvaeliasktlekfhqinavrvklskpnvalikstidylgvdifrq
    rn