PDB entry 1sqi

View 1sqi on RCSB PDB site
Description: Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases
Deposited on 2004-03-18, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.222
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqiA (A:)
    mttysnkgpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvsh
    vikqgkivfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivre
    pwveedkfgkvkfavlqtygdtthtlvekinytgrflpgfeaptykdtllpklpscnlei
    idhivgnqpdqemesasewylknlqfhrfwsvddtqvhteysslrsivvanyeesikmpi
    nepapgrkksqiqeyvdynggagvqhialrtediittirhlrergmeflavpssyyrllr
    enlktskiqvkenmdvleelkilvdydekgyllqiftkpmqdrptlfleviqrhnhqgfg
    agnfnslfkafeeeqalrgnltdletngvrsgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqiA (A:)
    gpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvshvikqgki
    vfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivrepwveedk
    fgkvkfavlqtygdtthtlvekinytgrflpgfeaptykdtllpklpscnleiidhivgn
    qpdqemesasewylknlqfhrfwsvlrsivvanyeesikmpinepasqiqeyvdynggag
    vqhialrtediittirhlrergmeflavpssyyrllrenlktskiqvkenmdvleelkil
    vdydekgyllqiftkpmqdrptlfleviqrhnhqgfgagnfns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sqiB (B:)
    mttysnkgpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvsh
    vikqgkivfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivre
    pwveedkfgkvkfavlqtygdtthtlvekinytgrflpgfeaptykdtllpklpscnlei
    idhivgnqpdqemesasewylknlqfhrfwsvddtqvhteysslrsivvanyeesikmpi
    nepapgrkksqiqeyvdynggagvqhialrtediittirhlrergmeflavpssyyrllr
    enlktskiqvkenmdvleelkilvdydekgyllqiftkpmqdrptlfleviqrhnhqgfg
    agnfnslfkafeeeqalrgnltdletngvrsgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqiB (B:)
    kgpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvshvikqgk
    ivfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivrepwveed
    kfgkvkfavlqtygdtthtlvekinytgrflpgfeaptykdtllpklpscnleiidhivg
    nqpdqemesasewylknlqfhrfwlrsivvanyeesikmpinepasqiqeyvdynggagv
    qhialrtediittirhlrergmeflavpssyyrllrenlktskiqvkenmdvleelkilv
    dydekgyllqiftkpmqdrptlfleviqrhnhqgfgagnfns