PDB entry 1sqi

View 1sqi on RCSB PDB site
Description: Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases
Class: biosynthetic protein
Keywords: rat 4-hydroxyphenylpyruvate dioxygenase, BIOSYNTHETIC PROTEIN
Deposited on 2004-03-18, released 2004-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.222
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylpyruvic acid dioxygenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sqia1, d1sqia2
  • Chain 'B':
    Compound: 4-hydroxyphenylpyruvic acid dioxygenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sqib1, d1sqib2
  • Heterogens: FE, 869, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqiA (A:)
    mttysnkgpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvsh
    vikqgkivfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivre
    pwveedkfgkvkfavlqtygdtthtlvekinytgrflpgfeaptykdtllpklpscnlei
    idhivgnqpdqemesasewylknlqfhrfwsvddtqvhteysslrsivvanyeesikmpi
    nepapgrkksqiqeyvdynggagvqhialrtediittirhlrergmeflavpssyyrllr
    enlktskiqvkenmdvleelkilvdydekgyllqiftkpmqdrptlfleviqrhnhqgfg
    agnfnslfkafeeeqalrgnltdletngvrsgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqiA (A:)
    gpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvshvikqgki
    vfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivrepwveedk
    fgkvkfavlqtygdtthtlvekinytgrflpgfeaptykdtllpklpscnleiidhivgn
    qpdqemesasewylknlqfhrfwsvlrsivvanyeesikmpinepasqiqeyvdynggag
    vqhialrtediittirhlrergmeflavpssyyrllrenlktskiqvkenmdvleelkil
    vdydekgyllqiftkpmqdrptlfleviqrhnhqgfgagnfns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sqiB (B:)
    mttysnkgpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvsh
    vikqgkivfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivre
    pwveedkfgkvkfavlqtygdtthtlvekinytgrflpgfeaptykdtllpklpscnlei
    idhivgnqpdqemesasewylknlqfhrfwsvddtqvhteysslrsivvanyeesikmpi
    nepapgrkksqiqeyvdynggagvqhialrtediittirhlrergmeflavpssyyrllr
    enlktskiqvkenmdvleelkilvdydekgyllqiftkpmqdrptlfleviqrhnhqgfg
    agnfnslfkafeeeqalrgnltdletngvrsgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqiB (B:)
    kgpkpergrflhfhsvtfwvgnakqaasfycnkmgfeplaykgletgsrevvshvikqgk
    ivfvlcsalnpwnkemgdhlvkhgdgvkdiafevedcehivqkarergakivrepwveed
    kfgkvkfavlqtygdtthtlvekinytgrflpgfeaptykdtllpklpscnleiidhivg
    nqpdqemesasewylknlqfhrfwlrsivvanyeesikmpinepasqiqeyvdynggagv
    qhialrtediittirhlrergmeflavpssyyrllrenlktskiqvkenmdvleelkilv
    dydekgyllqiftkpmqdrptlfleviqrhnhqgfgagnfns