PDB entry 1sqh

View 1sqh on RCSB PDB site
Description: x-ray structure of drosophila malonogaster protein q9vr51 northeast structural genomics consortium target fr87.
Deposited on 2004-03-18, released 2004-04-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sqha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqhA (A:)
    mssdkngdilrplsdsevdelldlykvkfgirnfhylllynqrkwdrqlseaqiprndln
    hislrkqfythrrgnfrtwgtyvslhrdivqsvsffswqpdgaaelwecleqtqliewtq
    galltnvdlgfcnrvkelavsrgvtaiqprqcfgmvlshedafcakvpdlpsefeirrlr
    aedaamvhdswpnkgegsltylqalvrfnkslgicrsdtgeliawifqndfsglgmlqvl
    pkaerrglggllaaamsreiargeeitltawivatnwrseallkrigyqkdlvnewiklv
    pnsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqhA (A:)
    gdilrplsdsevdelldlykvkfgirnfhylllynqrkwdrqlseaqiprndlnhislrk
    qfythrrgnfrtwgtyvslhrdivqsvsffswqpdgaaelwecleqtqliewtqgalltn
    vdlgfcnrvkelavsrgvtaiqprqcfgmvlshedafcakvpdlpsefeirrlraedaam
    vhdswpnkgegsltylqalvrfnkslgicrsdtgeliawifqndfsglgmlqvlpkaerr
    glggllaaamsreiargeeitltawivatnwrseallkrigyqkdlvnewiklvpns