PDB entry 1sqh

View 1sqh on RCSB PDB site
Description: x-ray structure of drosophila malonogaster protein q9vr51 northeast structural genomics consortium target fr87.
Class: structural genomics, unknown function
Keywords: structural genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2004-03-18, released 2004-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein CG14615-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VR51
      • modified residue (154)
      • modified residue (185)
      • modified residue (235)
      • modified residue (255)
    Domains in SCOPe 2.08: d1sqha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqhA (A:)
    mssdkngdilrplsdsevdelldlykvkfgirnfhylllynqrkwdrqlseaqiprndln
    hislrkqfythrrgnfrtwgtyvslhrdivqsvsffswqpdgaaelwecleqtqliewtq
    galltnvdlgfcnrvkelavsrgvtaiqprqcfgmvlshedafcakvpdlpsefeirrlr
    aedaamvhdswpnkgegsltylqalvrfnkslgicrsdtgeliawifqndfsglgmlqvl
    pkaerrglggllaaamsreiargeeitltawivatnwrseallkrigyqkdlvnewiklv
    pnsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqhA (A:)
    gdilrplsdsevdelldlykvkfgirnfhylllynqrkwdrqlseaqiprndlnhislrk
    qfythrrgnfrtwgtyvslhrdivqsvsffswqpdgaaelwecleqtqliewtqgalltn
    vdlgfcnrvkelavsrgvtaiqprqcfgmvlshedafcakvpdlpsefeirrlraedaam
    vhdswpnkgegsltylqalvrfnkslgicrsdtgeliawifqndfsglgmlqvlpkaerr
    glggllaaamsreiargeeitltawivatnwrseallkrigyqkdlvnewiklvpns