PDB entry 1sqf

View 1sqf on RCSB PDB site
Description: The crystal structure of E. coli Fmu binary complex with S-Adenosylmethionine at 2.1 A resolution
Class: transferase
Keywords: Rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain
Deposited on 2004-03-18, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.231
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SUN protein
    Species: Escherichia coli [TaxId:562]
    Gene: SUN, FMU, FMV, RSMB, B3289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sqfa1, d1sqfa2
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqfA (A:)
    mkkqrnlrsmaaqaveqvveqgqslsnilpplqqkvsdkdkallqelcfgvlrtlsqldw
    linklmarpmtgkqrtvhylimvglyqllytripphaalaetvegaiaikrpqlkgling
    vlrqfqrqqeellaefnasdarylhpswllkrlqkaypeqwqsiveannqrppmwlrinr
    thhsrdswlalldeagmkgfphadypdavrletpapvhalpgfedgwvtvqdasaqgcmt
    wlapqngehildlcaapggktthilevapeaqvvavdideqrlsrvydnlkrlgmkatvk
    qgdgrypsqwcgeqqfdrilldapcsatgvirrhpdikwlrrdrdipelaqlqseildai
    wphlktggtlvyatcsvlpeenslqikaflqrtadaelcetgtpeqpgkqnlpgaeegdg
    ffyaklikk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqfA (A:)
    rnlrsmaaqaveqvveqgqslsnilpplqqkvsdkdkallqelcfgvlrtlsqldwlink
    lmarpmtgkqrtvhylimvglyqllytripphaalaetvegaiaikrpqlkglingvlrq
    fqrqqeellaefnasdarylhpswllkrlqkaypeqwqsiveannqrppmwlrinrthhs
    rdswlalldeagmkgfphadypdavrletpapvhalpgfedgwvtvqdasaqgcmtwlap
    qngehildlcaapggktthilevapeaqvvavdideqrlsrvydnlkrlgmkatvkqgdg
    rypsqwcgeqqfdrilldapcsatgvirrhpdikwlrrdrdipelaqlqseildaiwphl
    ktggtlvyatcsvlpeenslqikaflqrtadaelcetgtpeqpgkqnlpgaeegdgffya
    klikk