PDB entry 1sqe

View 1sqe on RCSB PDB site
Description: 1.5A Crystal Structure Of the protein PG130 from Staphylococcus aureus, Structural genomics
Class: structural genomics,unknown function
Keywords: Structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, STRUCTURAL GENOMICS,UNKNOWN FUNCTION
Deposited on 2004-03-18, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.203
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PG130
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99X56 (1-108)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1sqea1, d1sqea2
  • Chain 'B':
    Compound: hypothetical protein PG130
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99X56 (1-108)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1sqeb1, d1sqeb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqeA (A:)
    hmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwes
    edsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqeA (A:)
    hmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwes
    edsfnnwlnsdvfkeahddgqqspilsnkvfkydigyhyqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sqeB (B:)
    hmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwes
    edsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqeB (B:)
    hmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwes
    edsfnnwlnsdvfkeavrlksdddgqqspilsnkvfkydigyhyqk