PDB entry 1sqe

View 1sqe on RCSB PDB site
Description: 1.5A Crystal Structure Of the protein PG130 from Staphylococcus aureus, Structural genomics
Deposited on 2004-03-18, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.203
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sqea_
  • Chain 'B':
    Domains in SCOP 1.69: d1sqeb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sqeA (A:)
    hmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwes
    edsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqeA (A:)
    hmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwes
    edsfnnwlnsdvfkeahddgqqspilsnkvfkydigyhyqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sqeB (B:)
    hmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwes
    edsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sqeB (B:)
    hmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwes
    edsfnnwlnsdvfkeavrlksdddgqqspilsnkvfkydigyhyqk