PDB entry 1sq9

View 1sq9 on RCSB PDB site
Description: Structure of Ski8p, a WD repeat protein involved in mRNA degradation and meiotic recombination
Class: antiviral protein, recombination
Keywords: WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, ANTIVIRAL PROTEIN, RECOMBINATION
Deposited on 2004-03-18, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antiviral protein SKI8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SKI8, REC103, YGL213C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sq9a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sq9A (A:)
    mskvfiatanagkahdadifsvsacnsftvscsgdgylkvwdnklldnenpkdksyshfv
    hksglhhvdvlqaierdafelclvattsfsgdllfyritredetkkvifekldlldsdmk
    khsfwalkwgasndrllshrlvatdvkgttyiwkfhpfadesnsltlnwsptlelqgtve
    spmtpsqfatsvdisergliatgfnngtvqiselstlrplynfesqhsminnsnsirsvk
    fspqgsllaiahdsnsfgcitlyetefgerigslsvpthssqaslgefahsswvmslsfn
    dsgetlcsagwdgklrfwdvktkerittlnmhcddieieedilavdehgdslaepgvfdv
    kflkkgwrsgmgadlneslccvcldrsirwfreaggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq9A (A:)
    kvfiatanagkahdadifsvsacnsftvscsgdgylkvwdnklldnenpkdksyshfvhk
    sglhhvdvlqaierdafelclvattsfsgdllfyritredetkkvifekldlldsdmkkh
    sfwalkwgasnshrlvatdvkgttyiwkfhpfadesnsltlnwsptlelqgtvespmtps
    qfatsvdisergliatgfnngtvqiselstlrplynfesqhnnsnsirsvkfspqgslla
    iahdsnsfgcitlyetefgerigslsvpgefahsswvmslsfndsgetlcsagwdgklrf
    wdvktkerittlnmhcddieieedilavdehgdslaepgvfdvkflkkgwrsgmgadlne
    slccvcldrsirwfreag