PDB entry 1sq8

View 1sq8 on RCSB PDB site
Description: a variant 434 repressor DNA binding domain devoid of hydroxyl groups, NMR, 20 STRUCTURES
Class: DNA binding protein
Keywords: HELIX-turn-Helix, DNA BINDING PROTEIN
Deposited on 2004-03-18, released 2004-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dh434
    Species: Phage 434 [TaxId:10712]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sq8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sq8A (A:)
    mlmgerirarriqlglnqaelaqkvgvdqqaieqlengkakrprflpelaralgvavdwl
    lnga