PDB entry 1sq7

View 1sq7 on RCSB PDB site
Description: understanding protein lids: structural analysis of active hinge mutants in triosephosphate isomerase
Deposited on 2004-03-18, released 2004-08-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-24, with a file datestamp of 2004-08-24.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.205
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sq7a_
  • Chain 'B':
    Domains in SCOP 1.69: d1sq7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sq7A (A:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtglwatpqqa
    qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sq7B (B:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtglwatpqqa
    qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh