PDB entry 1sq5

View 1sq5 on RCSB PDB site
Description: Crystal Structure of E. coli Pantothenate kinase
Class: transferase
Keywords: P-loop, TRANSFERASE
Deposited on 2004-03-17, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.187
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pantothenate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: COAA, RTS, PANK, B3974, C4933, Z5545, ECS4901
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sq5a_
  • Chain 'B':
    Compound: pantothenate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: COAA, RTS, PANK, B3974, C4933, Z5545, ECS4901
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sq5b_
  • Chain 'C':
    Compound: pantothenate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: COAA, RTS, PANK, B3974, C4933, Z5545, ECS4901
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sq5c_
  • Chain 'D':
    Compound: pantothenate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: COAA, RTS, PANK, B3974, C4933, Z5545, ECS4901
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sq5d_
  • Heterogens: PAU, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sq5A (A:)
    mtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyiss
    nlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittdg
    flhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdk
    tvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfr
    egaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanha
    veevrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq5A (A:)
    mtpylqfdrnqwaalrdmlsedeiarlkginedlsleevaeiylplsrllnfyissnlrr
    qavleqflgtnqripyiisiagsvavgksttarvlqallsrwpehrrvelittdgflhpn
    qvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdktvvpd
    ilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfregaftd
    pdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanhaveevrl
    rk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sq5B (B:)
    mtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyiss
    nlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittdg
    flhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdk
    tvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfr
    egaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanha
    veevrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq5B (B:)
    mtpylqfdrnqwaalrlsedeiarlkginedlsleevaeiylplsrllnfyissnlrrqa
    vleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittdgflhpnq
    vlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdktvvqpd
    ilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfregaftd
    pdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanhaveevrl
    rk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sq5C (C:)
    mtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyiss
    nlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittdg
    flhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdk
    tvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfr
    egaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanha
    veevrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq5C (C:)
    mtpylqfdrnqwaalrmtlsedeiarlkginedlsleevaeiylplsrllnfyissnlrr
    qavleqflgtnrpyiisiagsvavgksttarvlqallsrwpervelittdgflhpnqvlk
    erglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdktvvpdilil
    eglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfregaftdpdsy
    fhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanhaveevrlrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sq5D (D:)
    mtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyiss
    nlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittdg
    flhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdk
    tvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfr
    egaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanha
    veevrlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq5D (D:)
    mtpylqfdrnqwaalrdmtlsedeiarlkginedlsleevaeiylplsrllnfyissnlr
    rqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittdgflh
    pnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdktvv
    pdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfregaf
    tdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanhaveev
    rlrk