PDB entry 1sq4

View 1sq4 on RCSB PDB site
Description: Crystal Structure of the Putative Glyoxylate Induced Protein from Pseudomonas aeruginosa, Northeast Structural Genomics Target PaR14
Class: structural genomics, unknown function
Keywords: Structural Genomics, double beta barrel protein, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2004-03-17, released 2004-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyoxylate-induced Protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: 878039
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I4J5
      • modified residue (24)
      • modified residue (37)
      • modified residue (51)
      • modified residue (53)
      • modified residue (111)
      • modified residue (168)
      • modified residue (183)
      • modified residue (186)
      • modified residue (190)
      • modified residue (211)
      • modified residue (239)
      • modified residue (269)
    Domains in SCOPe 2.07: d1sq4a_
  • Chain 'B':
    Compound: Glyoxylate-induced Protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: 878039
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I4J5
      • modified residue (24)
      • modified residue (37)
      • modified residue (51)
      • modified residue (53)
      • modified residue (111)
      • modified residue (168)
      • modified residue (183)
      • modified residue (186)
      • modified residue (190)
      • modified residue (211)
      • modified residue (239)
      • modified residue (269)
    Domains in SCOPe 2.07: d1sq4b_
  • Heterogens: SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sq4A (A:)
    mskssyyaphgghpaqtelltdramfteayavipkgvmrdivtshlpfwdnmrmwviarp
    lsgfaetfsqyivelapnggsdkpeqdpnaeavlfvvegelsltlqgqvhamqpggyafi
    ppgadykvrnttgqhtrfhwirkhyqkvdgvplpeafvtneqdiqplvmpdtegrwsttr
    fvdmsdmrhdmhvnivnfepggvipfaethvmehglyvlegkavyrlnqdwveveagdfm
    wlrafcpqacysggpgrfryllykdvnrhmrltlnaph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq4A (A:)
    kssyyaphgghpalltdramfteayavipkgvmrdivtshlpfwdnmrmwviarplsgfa
    etfsqyivelapnggsdkpeqdpnaeavlfvvegelsltlqgqvhamqpggyafippgad
    ykvrnttgqhtrfhwirkhyqkvdgvplpeafvtneqdiqplvmpdtegrwsttrfvdms
    dmrhdmhvnivnfepggvipfaethvmehglyvlegkavyrlnqdwveveagdfmwlraf
    cpqacysggpgrfryllykdvnrhmrltln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sq4B (B:)
    mskssyyaphgghpaqtelltdramfteayavipkgvmrdivtshlpfwdnmrmwviarp
    lsgfaetfsqyivelapnggsdkpeqdpnaeavlfvvegelsltlqgqvhamqpggyafi
    ppgadykvrnttgqhtrfhwirkhyqkvdgvplpeafvtneqdiqplvmpdtegrwsttr
    fvdmsdmrhdmhvnivnfepggvipfaethvmehglyvlegkavyrlnqdwveveagdfm
    wlrafcpqacysggpgrfryllykdvnrhmrltlnaph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq4B (B:)
    kssyyaphgghpadramfteayavipkgvmrdivtshlpfwdnmrmwviarplsgfaetf
    sqyivelapnggsdkpeqdpnaeavlfvvegelsltlqgqvhamqpggyafippgadykv
    rnttgqhtrfhwirkhyqkvdgvplpeafvtneqdiqplvmpdtegrwsttrfvdmsdmr
    hdmhvnivnfepggvipfaethvmehglyvlegkavyrlnqdwveveagdfmwlrafcpq
    acysggpgrfryllykdvnrhmrltln