PDB entry 1sq3

View 1sq3 on RCSB PDB site
Description: Crystal structures of a novel open pore ferritin from the hyperthermophilic Archaeon Archaeoglobus fulgidus.
Class: metal binding protein
Keywords: Ferroxidase, four helix bundle, iron storage, METAL BINDING PROTEIN
Deposited on 2004-03-17, released 2005-04-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.179
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.01: d1sq3a_
  • Chain 'B':
    Compound: Ferritin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.01: d1sq3b_
  • Chain 'C':
    Compound: Ferritin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.01: d1sq3c_
  • Chain 'D':
    Compound: Ferritin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.01: d1sq3d_
  • Chain 'E':
    Compound: Ferritin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.01: d1sq3e_
  • Chain 'F':
    Compound: Ferritin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.01: d1sq3f_
  • Chain 'G':
    Compound: Ferritin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.01: d1sq3g_
  • Chain 'H':
    Compound: Ferritin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.01: d1sq3h_
  • Chain 'I':
    Compound: Ferritin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.01: d1sq3i_
  • Chain 'J':
    Compound: Ferritin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.01: d1sq3j_
  • Chain 'K':
    Compound: Ferritin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.01: d1sq3k_
  • Chain 'L':
    Compound: Ferritin
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.01: d1sq3l_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sq3A (A:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq3A (A:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sq3B (B:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq3B (B:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sq3C (C:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq3C (C:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sq3D (D:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq3D (D:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sq3E (E:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq3E (E:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sq3F (F:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq3F (F:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1sq3G (G:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq3G (G:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1sq3H (H:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq3H (H:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1sq3I (I:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq3I (I:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1sq3J (J:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq3J (J:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1sq3K (K:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq3K (K:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1sq3L (L:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq3L (L:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq