PDB entry 1sq1

View 1sq1 on RCSB PDB site
Description: Crystal Structure of the Chorismate Synthase from Campylobacter jejuni, Northeast Structural Genomics Target BR19
Class: lyase
Keywords: Structural Genomics, Bifunctional alpha/beta tetrameric protein, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, LYASE
Deposited on 2004-03-17, released 2004-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chorismate synthase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: AROC OR CJ1634
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PM41 (0-End)
      • modified residue (0)
      • modified residue (27)
      • modified residue (139)
      • modified residue (213)
      • modified residue (234)
      • modified residue (253)
      • modified residue (334)
    Domains in SCOPe 2.08: d1sq1a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sq1A (A:)
    mntfgtrlkftsfgeshgvavgciidgmpagvkfdeeflqneldkrkggskfatprkesd
    kaqvlsgvfegyttghpiaivvfnenahskdydnlkdlfrpahadftyfykygirdhrgg
    grssaresvarvaggavaamllrefdicvqsgvfgvgtfvsnlkeeefdfefakkseifc
    ldpklesdfkneilnarnskdsvgaavftkvsgmliglgevlydkldsklahalmginav
    kaveigeginaskmrgscnndalkdgkflsnhsggilggisngenlilktyfkptpsifa
    kqesidkfgnnlkfelkgrhdpcvgvrgsvvasamvrlvladclllnasanlnnlknayg
    lklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sq1A (A:)
    mntfgtrlkftsfgeshgvavgciidgmpagvkfdeeflqneldkrkgdkaqvlsgvfeg
    yttghpiaivvfsaresvarvaggavaamllrefdicvqsgvfgvgtfvsnlkeeefdfe
    fakkseifcldpklesdfkneilnarnskdsvgaavftkvsgmliglgevlydkldskla
    halmginavkaveigeginaskmrgscnndalkdgkflsnhsggilggisngenlilkty
    fkptpgrhdpcvgvrgsvvasamvrlvladclllnasanlnnlknayg