PDB entry 1spy

View 1spy on RCSB PDB site
Description: regulatory domain of human cardiac troponin c in the calcium-free state, nmr, 40 structures
Class: muscle protein
Keywords: muscle protein, calcium-binding, troponin c, muscle regulation
Deposited on 1997-07-14, released 1998-09-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: troponin c
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63316 (0-88)
  Domains in SCOPe 2.03: d1spya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1spyA (A:)
  mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
  idevdedgsgtvdfdeflvmmvrcmkdds