PDB entry 1spx

View 1spx on RCSB PDB site
Description: Crystal Structure of Glucose Dehydrogenase of Caenorhabditis Elegans in the Apo-Form
Class: oxidoreductase
Keywords: Parallel beta-sheet of seven strands in the order 3214567; three alpha-helices on either side of beta-sheet; seventh alpha-helix on top of beta-sheet, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG
Deposited on 2004-03-17, released 2004-03-23
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-01, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: short-chain reductase family member (5L265)
    Species: Caenorhabditis elegans
    Gene: D1054.8
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1spxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1spxA (A:)
    mtrfaekvaiitgssngigratavlfaregakvtitgrhaerleetrqqilaagvseqnv
    nsvvadvttdagqdeilsttlgkfgkldilvnnagaaipdsqsktgtaqsiesydatlnl
    nlrsvialtkkavphlsstkgeivnissiasglhatpdfpyysiakaaidqytrntaidl
    iqhgirvnsispglvatgfgsamgmpeetskkfystmatmkecvpagvmgqpqdiaevia
    fladrktssyiighqlvvdggsslimglhcqdfakllh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1spxA (A:)
    trfaekvaiitgssngigratavlfaregakvtitgrhaerleetrqqilaagvseqnvn
    svvadvttdagqdeilsttlgkfgkldilvnnagqsiesydatlnlnlrsvialtkkavp
    hlsstkgeivnissiasglhatpdfpyysiakaaidqytrntaidliqhgirvnsispgl
    vatgfystmatmkecvpagvmgqpqdiaeviafladrktssyiighqlvvdggssli