PDB entry 1spu

View 1spu on RCSB PDB site
Description: structure of oxidoreductase
Class: oxidoreductase
Keywords: oxidoreductase, copper, tpq, periplasmic, signal
Deposited on 1996-11-13, released 1997-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper amine oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46883
      • modified residue (465)
    Domains in SCOPe 2.06: d1spua1, d1spua2, d1spua3, d1spua4
  • Chain 'B':
    Compound: copper amine oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46883
      • modified residue (465)
    Domains in SCOPe 2.06: d1spub1, d1spub2, d1spub3, d1spub4
  • Heterogens: CU, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1spuA (A:)
    hggeahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvp
    vvmkdnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpn
    trfteisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpi
    kdahgmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqda
    rllkvisyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
    pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
    slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
    meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
    gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
    nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
    vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
    dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
    galkkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1spuA (A:)
    mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
    kawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrftei
    sllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahgm
    vllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkvi
    syldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkpm
    qiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggmi
    vpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeipra
    iavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigidaga
    tgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslvam
    dpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqii
    pyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglgq
    yskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1spuB (B:)
    hggeahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvp
    vvmkdnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpn
    trfteisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpi
    kdahgmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqda
    rllkvisyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
    pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
    slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
    meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
    gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
    nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
    vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
    dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
    galkkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1spuB (B:)
    hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
    nkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrfte
    isllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahg
    mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
    isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkp
    mqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggm
    ivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeipr
    aiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigidag
    atgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslva
    mdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqi
    ipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglg
    qyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalkk