PDB entry 1sps

View 1sps on RCSB PDB site
Description: binding of a high affinity phosphotyrosyl peptide to the src sh2 domain: crystal structures of the complexed and peptide-free forms
Class: transferase(phosphotransferase)
Keywords: transferase(phosphotransferase)
Deposited on 1993-03-05, released 1994-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.18
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: src sh2 domain
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1spsa_
  • Chain 'B':
    Compound: src sh2 domain
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1spsb_
  • Chain 'C':
    Compound: src sh2 domain
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1spsc_
  • Chain 'D':
    Compound: peptide yeei
    Species: Hamster polyomavirus [TaxId:10626]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: peptide yeei
    Species: Hamster polyomavirus [TaxId:10626]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: peptide yeei
    Species: Hamster polyomavirus [TaxId:10626]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1spsA (A:)
    qaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
    irkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1spsA (A:)
    aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
    rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1spsB (B:)
    qaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
    irkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1spsB (B:)
    aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
    rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1spsC (C:)
    qaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
    irkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1spsC (C:)
    aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
    rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.