PDB entry 1spk

View 1spk on RCSB PDB site
Description: Solution Structure of RSGI RUH-010, an SH3 Domain from Mouse cDNA
Class: structural genomics, unknown function
Keywords: structural genomics, SH3 domain, five-stranded barrel, mouse cDNA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-03-17, released 2004-09-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RIKEN cDNA 1300006M19
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 1300006M19
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9DBJ3 (7-65)
    • cloning artifact (0-6)
    • cloning artifact (66-71)
  Domains in SCOPe 2.06: d1spka1, d1spka2, d1spka3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1spkA (A:)
  gssgssgqkvktifphtagnnktllsfaqgdvltllipeekdgwlygehdttkargwfps
  sytkllsgpssg