PDB entry 1spj

View 1spj on RCSB PDB site
Description: structure of mature human tissue kallikrein (human kallikrein 1 or klk1) at 1.70 angstrom resolution with vacant active site
Class: hydrolase
Keywords: Serine protease, KLK1, hK1, Human kallikrein 1, Human tissue kallikrein 1, Tissue kallikrein, HYDROLASE
Deposited on 2004-03-16, released 2005-01-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.172
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kallikrein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06870 (0-237)
      • engineered (120)
      • engineered (161)
    Domains in SCOPe 2.01: d1spja_
  • Heterogens: NAG, CA, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1spjA (A:)
    ivggweceqhsqpwqaalyhfstfqcggilvhrqwvltaahcisdnyqlwlgrhnlfdde
    ntaqfvhvsesfphpgfnmsllenhtrqadedyshdlmllrltepadtitdavkvvelpt
    eepevgstclasgwgsiepenfsfpddlqcvdlkilpndeckkahvqkvtdfmlcvghle
    ggkdtcvgdsggplmcdgvlqgvtswgyvpcgtpnkpsvavrvlsyvkwiedtiaens
    

    Sequence, based on observed residues (ATOM records): (download)
    >1spjA (A:)
    ivggweceqhsqpwqaalyhfstfqcggilvhrqwvltaahcisdnyqlwlgrhnlfdde
    ntaqfvhvsesfphpgfnmsllenrqadedyshdlmllrltepadtitdavkvvelptee
    pevgstclasgwgsiepenfsfpddlqcvdlkilpndeckkahvqkvtdfmlcvghlegg
    kdtcvgdsggplmcdgvlqgvtswgyvpcgtpnkpsvavrvlsyvkwiedtiaens