PDB entry 1spb

View 1spb on RCSB PDB site
Description: subtilisin bpn' prosegment (77 residues) complexed with a mutant subtilisin bpn' (266 residues). crystal ph 4.6. crystallization temperature 20 c diffraction temperature-160 c
Class: complex (serine proteinase/prosegment)
Keywords: propeptide, foldase, folding catalyst, activation domain, complex (serine proteinase/prosegment) complex
Deposited on 1995-06-21, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: subtilisin bpn' prosegment
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1spbp_
  • Chain 'S':
    Compound: subtilisin bpn'
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00782 (Start-265)
      • engineered (31)
      • engineered (42)
      • engineered (49)
      • engineered (72)
      • engineered (196)
      • engineered (207-208)
      • engineered (211)
    Domains in SCOPe 2.08: d1spbs_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1spbP (P:)
    agsngaqekkyivgfkqtmstmsaakkkdvisekggkvqkqfkyvdaasatlnekavkel
    kkdpsvayveedhvahay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1spbP (P:)
    ekkyivgfkqtmstmsaakkkdvisekggkvqkqfkyvdaasatlnekavkelkkdpsva
    yveedhvahay
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1spbS (S:)
    aqsvpygvsqikapalhsqgytgsnvkvavinsgidsshpdlnvaggasfvpsetnpfqd
    nnshgthvagtvlavapsaslyavkvlgadgsgqyswiingiewaiannmdvinmslggp
    sgsaalkaavdkavasgvvvvaaagnegtsgssstvgypgkypsviavgavdssnqrasf
    ssvgpeldvmapgvsivstlpgnkygaksgtamasphvagaaalilskhpnwtntqvrss
    lentttklgdsfyygkglinvqaaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1spbS (S:)
    svpygvsqikapalhsqgytgsnvkvavinsgidsshpdlnvaggasfvpsetnpfqdnn
    shgthvagtvlavapsaslyavkvlgadgsgqyswiingiewaiannmdvinmslggpsg
    saalkaavdkavasgvvvvaaagnegtsgssstvgypgkypsviavgavdssnqrasfss
    vgpeldvmapgvsivstlpgnkygaksgtamasphvagaaalilskhpnwtntqvrssle
    ntttklgdsfyygkglinvqaaaq