PDB entry 1sp3

View 1sp3 on RCSB PDB site
Description: crystal structure of octaheme cytochrome c from shewanella oneidensis
Deposited on 2004-03-16, released 2004-09-21
The last revision prior to the SCOP 1.69 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.16
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sp3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sp3A (A:)
    anphkdvlkgpfttgsevttqcltcheeqatdmmktshwtweleqklpdrtvvrgkknsi
    nnfcvaissneprctschagygwkdntfdfkdktkvdclichdttgtyvkdpagagepma
    kldlakiaqnvgapvrdncgschfyggggdavkhgdldssmaypdkatdvhmdsdgnnfq
    cqnchttekhqisgnamgvspggidhigcenchdsaphsnkklnthtatvacqtchipff
    akneptkmqwdwstagddkpetvdqygkhtyqkkkgnfvwekmvkpqyawyngtanayma
    gdkmdsnvvtkltypmgdindakakiypfkvhtgkqiydkklnifitpktygkggywsef
    dwnlaaklgmeanptmlekgikysgeydfaatemwwrinhmvspkeqalncndchnkgtr
    ldwqalgyqgdpmknkqgpkhkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sp3A (A:)
    anphkdvlkgpfttgsevttqcltcheeqatdmmktshwtweleqklpdrtvvrgkknsi
    nnfcvaissneprctschagygwkdntfdfkdktkvdclichdttgtyvkdpagagepma
    kldlakiaqnvgapvrdncgschfygkhgdldssmaypdkatdvhmdsdgnnfqcqncht
    tekhqisgnamgvspggidhigcenchdsaphsnkklnthtatvacqtchipffaknept
    kmqwdwstagddkpetvdqygkhtyqkkkgnfvwekmvkpqyawyngtanaymagdkmds
    nvvtkltypmgdindakakiypfkvhtgkqiydkklnifitpktygkggywsefdwnlaa
    klgmeanptmlekgikysgeydfaatemwwrinhmvspkeqalncndchnkgtrldwqal
    gyqgdpmknkqgpkhk