PDB entry 1sp3

View 1sp3 on RCSB PDB site
Description: Crystal structure of octaheme cytochrome c from Shewanella oneidensis
Class: oxidoreductase
Keywords: octaheme, cytochrome c, oxidoreductase
Deposited on 2004-03-16, released 2004-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c, putative
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO4144 (tigr locus)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8E9W8 (0-End)
      • conflict (210)
    Domains in SCOPe 2.08: d1sp3a_
  • Heterogens: SCN, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sp3A (A:)
    anphkdvlkgpfttgsevttqcltcheeqatdmmktshwtweleqklpdrtvvrgkknsi
    nnfcvaissneprctschagygwkdntfdfkdktkvdclichdttgtyvkdpagagepma
    kldlakiaqnvgapvrdncgschfyggggdavkhgdldssmaypdkatdvhmdsdgnnfq
    cqnchttekhqisgnamgvspggidhigcenchdsaphsnkklnthtatvacqtchipff
    akneptkmqwdwstagddkpetvdqygkhtyqkkkgnfvwekmvkpqyawyngtanayma
    gdkmdsnvvtkltypmgdindakakiypfkvhtgkqiydkklnifitpktygkggywsef
    dwnlaaklgmeanptmlekgikysgeydfaatemwwrinhmvspkeqalncndchnkgtr
    ldwqalgyqgdpmknkqgpkhkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sp3A (A:)
    anphkdvlkgpfttgsevttqcltcheeqatdmmktshwtweleqklpdrtvvrgkknsi
    nnfcvaissneprctschagygwkdntfdfkdktkvdclichdttgtyvkdpagagepma
    kldlakiaqnvgapvrdncgschfygkhgdldssmaypdkatdvhmdsdgnnfqcqncht
    tekhqisgnamgvspggidhigcenchdsaphsnkklnthtatvacqtchipffaknept
    kmqwdwstagddkpetvdqygkhtyqkkkgnfvwekmvkpqyawyngtanaymagdkmds
    nvvtkltypmgdindakakiypfkvhtgkqiydkklnifitpktygkggywsefdwnlaa
    klgmeanptmlekgikysgeydfaatemwwrinhmvspkeqalncndchnkgtrldwqal
    gyqgdpmknkqgpkhk