PDB entry 1sp2

View 1sp2 on RCSB PDB site
Description: nmr structure of a zinc finger domain from transcription factor sp1f2, minimized average structure
Deposited on 1996-11-21, released 1997-04-21
The last revision prior to the SCOP 1.57 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1sp2__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sp2_ (-)
    rpfmctwsycgkrftrsdelqrhkrthtgek