PDB entry 1sp2

View 1sp2 on RCSB PDB site
Description: nmr structure of a zinc finger domain from transcription factor sp1f2, minimized average structure
Class: zinc finger
Keywords: zinc finger, transcription activation, sp1
Deposited on 1996-11-21, released 1997-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sp1f2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08047 (0-30)
  Domains in SCOPe 2.08: d1sp2a_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sp2A (A:)
  rpfmctwsycgkrftrsdelqrhkrthtgek