PDB entry 1sp0

View 1sp0 on RCSB PDB site
Description: solution structure of apocox11
Deposited on 2004-03-16, released 2004-08-10
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1sp0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sp0A (A:)
    mvplydmfcrvtgyngttqrveqasdlildekikvtfdanvaaglpwefvpvqrdidvri
    getvqimyraknlastpttgqatfnvtpmaagayfnkvqcfcftettlepgeemempvvf
    fvdpeivkpvetqgiktltlsytfyprepskpvaqvkakaenkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sp0A (A:)
    veqasdlildekikvtfdanvaaglpwefvpvqrdidvrigetvqimyraknlastpttg
    qatfnvtpmaagayfnkvqcfcftettlepgeemempvvffvdpeivkpvetqgiktltl
    sytfyprepsk