PDB entry 1sox

View 1sox on RCSB PDB site
Description: sulfite oxidase from chicken liver
Deposited on 1997-12-31, released 1998-04-29
The last revision prior to the SCOP 1.67 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1748
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1soxA (A:)
    apsypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwa
    lyavhgephvlellqqykvgelspdeapaapdaqdpfagdpprhpglrvnsqkpfnaepp
    aellaerfltpnelfftrnhlpvpavepssyrlrvdgpgggtlslslaelrsrfpkhevt
    atlqcagnrrsemsrvrpvkglpwdigaistarwggarlrdvllhagfpeelqgewhvcf
    egldadpggapygasipygralspaadvllayemngtelprdhgfpvrvvvpgvvgarsv
    kwlrrvavspdespshwqqndykgfspcvdwdtvdyrtapaiqelpvqsavtqprpgaav
    ppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkappgrawawalweltvpve
    agteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvsvqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1soxA (A:)
    sypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwaly
    avhgephvlellqqykvgelspdeapapdaqdpfagdpprhpglrvnsqkpfnaeppael
    laerfltpnelfftrnhlpvpavepssyrlrvdgpgggtlslslaelrsrfpkhevtatl
    qcagnrrsemsrvrpvkglpwdigaistarwggarlrdvllhagfpeelqgewhvcfegl
    dadpggapygasipygralspaadvllayemngtelprdhgfpvrvvvpgvvgarsvkwl
    rrvavspdespshwqqndykgfspcvdwdtvdyrtapaiqelpvqsavtqprpgaavppg
    eltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkappgrawawalweltvpveagt
    eleivckavdssynvqpdsvapiwnlrgvlstawhrvrvsvqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1soxB (B:)
    apsypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwa
    lyavhgephvlellqqykvgelspdeapaapdaqdpfagdpprhpglrvnsqkpfnaepp
    aellaerfltpnelfftrnhlpvpavepssyrlrvdgpgggtlslslaelrsrfpkhevt
    atlqcagnrrsemsrvrpvkglpwdigaistarwggarlrdvllhagfpeelqgewhvcf
    egldadpggapygasipygralspaadvllayemngtelprdhgfpvrvvvpgvvgarsv
    kwlrrvavspdespshwqqndykgfspcvdwdtvdyrtapaiqelpvqsavtqprpgaav
    ppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkappgrawawalweltvpve
    agteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvsvqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1soxB (B:)
    sypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwaly
    avhgephvlellqqykvgelspddaqdpfagdpprhpglrvnsqkpfnaeppaellaerf
    ltpnelfftrnhlpvpavepssyrlrvdgpgggtlslslaelrsrfpkhevtatlqcagn
    rrsemsrvrpvkglpwdigaistarwggarlrdvllhagfpeelqgewhvcfegldadpg
    gapygasipygralspaadvllayemngtelprdhgfpvrvvvpgvvgarsvkwlrrvav
    spdespshwqqndykgfspcvdwdtvdyrtapaiqelpvqsavtqprpgaavppgeltvk
    gyawsgggrevvrvdvsldggrtwkvarlmgdkappgrawawalweltvpveagteleiv
    ckavdssynvqpdsvapiwnlrgvlstawhrvrvsvqd