PDB entry 1sou

View 1sou on RCSB PDB site
Description: NMR structure of Aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: Northeast Structural Genomics Consortium Target QR46
Class: Ligase
Keywords: Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Ligase
Deposited on 2004-03-15, released 2004-06-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 5,10-methenyltetrahydrofolate synthetase
  Species: Aquifex aeolicus [TaxId:63363]
  Gene: aq_1731
  Database cross-references and differences (RAF-indexed):
  • Uniprot O67621 (0-185)
    • cloning artifact (186-187)
    • expression tag (188-193)
  Domains in SCOPe 2.05: d1soua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1souA (A:)
  mlkselrkkvlhkrinlseeerrrlsekvisnlkslpefkkskkvalycpikgevdltpl
  fpevlkekelilpkvegneislyrvhspaclgvgafgimepvegervnpedvdfiavpgv
  afdlegyrlgfgkgyydrllkrvkglkvgvaysfqvferlprdawdipvdvlvteknvrr
  lrdgrslehhhhhh