PDB entry 1sou

View 1sou on RCSB PDB site
Description: nmr structure of aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: northeast structural genomics consortium target qr46
Deposited on 2004-03-15, released 2004-06-22
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1soua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1souA (A:)
mlkselrkkvlhkrinlseeerrrlsekvisnlkslpefkkskkvalycpikgevdltpl
fpevlkekelilpkvegneislyrvhspaclgvgafgimepvegervnpedvdfiavpgv
afdlegyrlgfgkgyydrllkrvkglkvgvaysfqvferlprdawdipvdvlvteknvrr
lrdgrslehhhhhh