PDB entry 1sou

View 1sou on RCSB PDB site
Description: NMR structure of Aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: Northeast Structural Genomics Consortium Target QR46
Class: Ligase
Keywords: Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Ligase
Deposited on 2004-03-15, released 2004-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5,10-methenyltetrahydrofolate synthetase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: aq_1731
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67621 (0-185)
      • cloning artifact (186-187)
      • expression tag (188-193)
    Domains in SCOPe 2.08: d1soua1, d1soua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1souA (A:)
    mlkselrkkvlhkrinlseeerrrlsekvisnlkslpefkkskkvalycpikgevdltpl
    fpevlkekelilpkvegneislyrvhspaclgvgafgimepvegervnpedvdfiavpgv
    afdlegyrlgfgkgyydrllkrvkglkvgvaysfqvferlprdawdipvdvlvteknvrr
    lrdgrslehhhhhh