PDB entry 1sot

View 1sot on RCSB PDB site
Description: Crystal Structure of the DegS stress sensor
Class: hydrolase
Keywords: stress response, protein quality control, PDZ, UPR, HtrA, hydrolase
Deposited on 2004-03-15, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease degS
    Species: Escherichia coli [TaxId:562]
    Gene: DEGS, HHOB, HTRH, B3235, Z4594, ECS4108
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31137 (1-End)
      • modified residue (0)
      • modified residue (43)
      • modified residue (171)
      • modified residue (203)
      • modified residue (277)
    Domains in SCOPe 2.07: d1sota1, d1sota2, d1sota3
  • Chain 'B':
    Compound: Protease degS
    Species: Escherichia coli [TaxId:562]
    Gene: DEGS, HHOB, HTRH, B3235, Z4594, ECS4108
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31137 (1-313)
      • modified residue (0)
      • modified residue (43)
      • modified residue (171)
      • modified residue (203)
      • modified residue (277)
      • modified residue (294)
      • expression tag (314-319)
    Domains in SCOPe 2.07: d1sotb1, d1sotb2, d1sotb3
  • Chain 'C':
    Compound: Protease degS
    Species: Escherichia coli [TaxId:562]
    Gene: DEGS, HHOB, HTRH, B3235, Z4594, ECS4108
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31137 (1-End)
      • modified residue (0)
      • modified residue (43)
      • modified residue (171)
      • modified residue (203)
      • modified residue (277)
    Domains in SCOPe 2.07: d1sotc1, d1sotc2, d1sotc3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sotA (A:)
    mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
    dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
    ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
    ksndgetpegigfaipfqlatkimdklirdgrvirgyigiggreiaplhaqgggidqlqg
    ivvnevspdgpaanagiqvndliisvdnkpaisaletmdqvaeirpgsvipvvvmrddkq
    ltlqvtiqeypatnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sotA (A:)
    mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
    dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
    ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
    egigfaipfqlatkimdklirdgrvirgyigiggrgivvnevspdgpaanagiqvndlii
    svdnkpaisaletmdqvaeirpgsvipvvvqltlqvtiqeypa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sotB (B:)
    mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
    dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
    ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
    ksndgetpegigfaipfqlatkimdklirdgrvirgyigiggreiaplhaqgggidqlqg
    ivvnevspdgpaanagiqvndliisvdnkpaisaletmdqvaeirpgsvipvvvmrddkq
    ltlqvtiqeypatnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sotB (B:)
    mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
    dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
    ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
    pegigfaipfqlatkimdklirdgrvirgyigiggrqgivvnevspdgpaanagiqvndl
    iisvdnkpaisaletmdqvaeirpgsvipvvvmqltlqvtiqeypatnhhhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sotC (C:)
    mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
    dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
    ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
    ksndgetpegigfaipfqlatkimdklirdgrvirgyigiggreiaplhaqgggidqlqg
    ivvnevspdgpaanagiqvndliisvdnkpaisaletmdqvaeirpgsvipvvvmrddkq
    ltlqvtiqeypatnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sotC (C:)
    mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
    dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
    ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
    egigfaipfqlatkimdklirdgrvirgyigiggrgivvnevspdgpaanagiqvndlii
    svdnkpaisaletmdqvaeirpgsvipvltlqvtiqeypat