PDB entry 1sor

View 1sor on RCSB PDB site
Description: aquaporin-0 membrane junctions reveal the structure of a closed water pore
Deposited on 2004-03-15, released 2004-05-11
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-11, with a file datestamp of 2004-05-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.299
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1sora_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sorA (A:)
rsasfwraifaeffatlfyvffglgaslrwapgplhvlqvalafglalatlvqavghisg
ahvnpavtfaflvgsqmsllraicyvvaqllgavagaavlysvtppavrgnlalntlhpg
vsvgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmn
parsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg