PDB entry 1soq

View 1soq on RCSB PDB site
Description: crystal structure of the transthyretin mutant a108y/l110e solved in space group c2
Deposited on 2004-03-15, released 2004-07-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-06, with a file datestamp of 2004-07-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1soqa_
  • Chain 'B':
    Domains in SCOP 1.69: d1soqb_
  • Chain 'C':
    Domains in SCOP 1.69: d1soqc_
  • Chain 'D':
    Domains in SCOP 1.69: d1soqd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1soqA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiyaelspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1soqA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiyaelspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1soqB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiyaelspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1soqB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiyaelspysysttavvtn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1soqC (C:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiyaelspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1soqC (C:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiyaelspysysttavvtnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1soqD (D:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiyaelspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1soqD (D:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiyaelspysysttavvtn