PDB entry 1sok

View 1sok on RCSB PDB site
Description: Crystal structure of the transthyretin mutant A108Y/L110E solved in space group p21212
Class: transport protein
Keywords: greek key beta barrel, transport protein
Deposited on 2004-03-15, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.225
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (107)
      • engineered (109)
    Domains in SCOPe 2.07: d1soka_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (107)
      • engineered (109)
    Domains in SCOPe 2.07: d1sokb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sokA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiyaelspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sokA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiyaelspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sokB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiyaelspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sokB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiyaelspysysttavvtn