PDB entry 1soj

View 1soj on RCSB PDB site
Description: catalytic domain of human phosphodiesterase 3b in complex with ibmx
Deposited on 2004-03-15, released 2004-05-11
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-11, with a file datestamp of 2004-05-11.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.231
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1soja_
  • Chain 'B':
    Domains in SCOP 1.67: d1sojb_
  • Chain 'C':
    Domains in SCOP 1.67: d1sojc_
  • Chain 'D':
    Domains in SCOP 1.67: d1sojd_
  • Chain 'E':
    Domains in SCOP 1.67: d1soje_
  • Chain 'F':
    Domains in SCOP 1.67: d1sojf_
  • Chain 'G':
    Domains in SCOP 1.67: d1sojg_
  • Chain 'H':
    Domains in SCOP 1.67: d1sojh_
  • Chain 'I':
    Domains in SCOP 1.67: d1soji_
  • Chain 'J':
    Domains in SCOP 1.67: d1sojj_
  • Chain 'K':
    Domains in SCOP 1.67: d1sojk_
  • Chain 'L':
    Domains in SCOP 1.67: d1sojl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sojA (A:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sojA (A:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngriayisskscsn
    pdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenhh
    aasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakandvns
    ngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpis
    pfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaesrrrifcqlmhhltenh
    kiwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sojB (B:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sojB (B:)
    evsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifki
    ptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngdgrinhgri
    ayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavly
    ndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflae
    fnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgd
    eeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaeedndtes
    srrrifcqlmhhltenhkiwk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sojC (C:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sojC (C:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngriayisskscsn
    pdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenhh
    aasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakandvns
    ngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpis
    pfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaesrrrifcqlmhhltenh
    kiwk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sojD (D:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sojD (D:)
    evsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifki
    ptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngdgrinhgri
    ayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavly
    ndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflae
    fnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgd
    eeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaeedndtes
    srrrifcqlmhhltenhkiwk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sojE (E:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sojE (E:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngriayisskscsn
    pdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenhh
    aasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakandvns
    ngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpis
    pfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaesrrrifcqlmhhltenh
    kiwk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sojF (F:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sojF (F:)
    evsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifki
    ptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngdgrinhgri
    ayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavly
    ndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflae
    fnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgd
    eeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaeedndtes
    srrrifcqlmhhltenhkiwk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1sojG (G:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sojG (G:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngriayisskscsn
    pdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenhh
    aasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakandvns
    ngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpis
    pfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaesrrrifcqlmhhltenh
    kiwk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1sojH (H:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sojH (H:)
    evsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifki
    ptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngdgrinhgri
    ayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavly
    ndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflae
    fnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgd
    eeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaeedndtes
    srrrifcqlmhhltenhkiwk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1sojI (I:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlllhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sojI (I:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngriayisskscsn
    pdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenhh
    aasawnlylsrpeynfllhldhvefkrfrflvieailatdlllhfdflaefnakandvns
    ngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpis
    pfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaesrrrifcqlmhhltenh
    kiwk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1sojJ (J:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sojJ (J:)
    evsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifki
    ptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngdgrinhgri
    ayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavly
    ndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflae
    fnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgd
    eeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaeedndtes
    srrrifcqlmhhltenhkiwk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1sojK (K:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sojK (K:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngriayisskscsn
    pdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenhh
    aasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakandvns
    ngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpis
    pfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaesrrrifcqlmhhltenh
    kiwk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1sojL (L:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sojL (L:)
    evsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifki
    ptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngdgrinhgri
    ayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavly
    ndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflae
    fnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgd
    eeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaeedndtes
    srrrifcqlmhhltenhkiwk