PDB entry 1soi

View 1soi on RCSB PDB site
Description: crystal structure of nudix hydrolase dr1025 in complex with sm+3
Class: hydrolase
Keywords: NUDIX FOLD, alpha-beta-alpha sandwich, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, HYDROLASE
Deposited on 2004-03-15, released 2004-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MutT/nudix family protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR1025
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1soia_
  • Heterogens: SM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1soiA (A:)
    mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqd
    aavreaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeas
    fvsredfaqlyaagqirmyqtklfyadalrekgfpalpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1soiA (A:)
    ehderthvpvelraagvvllnergdillvqekgihpekaglwhipsgavedgenpqdaav
    reaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasfvs
    redfaqlyaagqirmyqtklfyadalrekgfpalpv