PDB entry 1sog

View 1sog on RCSB PDB site
Description: Cyrstal Structure of Cytochrome c Peroxidase Mutant: CcPK2M2
Class: oxidoreductase
Keywords: CcP, Heme Peroxidase, Cytochrome c Peroxidase, Haem Peroxidase, OXIDOREDUCTASE
Deposited on 2004-03-14, released 2004-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.166
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-293)
      • engineered (175)
      • engineered (191)
      • engineered (193)
      • engineered (198)
      • engineered (200)
      • engineered (229-230)
    Domains in SCOPe 2.06: d1soga_
  • Heterogens: K, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sogA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahtlgkt
    hlknsgyegpwtannnvfdnsfylnllnedwklekndanneqwdsksgylqlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl