PDB entry 1sog

View 1sog on RCSB PDB site
Description: Cyrstal Structure of Cytochrome c Peroxidase Mutant: CcPK2M2
Deposited on 2004-03-14, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.166
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1soga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sogA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahtlgkt
    hlknsgyegpwtannnvfdnsfylnllnedwklekndanneqwdsksgylqlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl