PDB entry 1sof

View 1sof on RCSB PDB site
Description: Crystal structure of the azotobacter vinelandii bacterioferritin at 2.6 A resolution
Class: electron transport
Keywords: bacterioferritin, active as 24-mer, four-helix bundle, electron transport
Deposited on 2004-03-14, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sofa1
  • Chain 'B':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sofb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sofc_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sofd_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sofe_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1soff_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sofg_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sofh_
  • Heterogens: FE2, MG, BA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sofA (A:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sofA (A:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sofB (B:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sofB (B:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sofC (C:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sofC (C:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sofD (D:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sofD (D:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sofE (E:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sofE (E:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sofF (F:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sofF (F:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1sofG (G:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sofG (G:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1sofH (H:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sofH (H:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd