PDB entry 1so9

View 1so9 on RCSB PDB site
Description: Solution Structure of apoCox11, 30 structures
Class: metal transport
Keywords: immunoglobulin-like fold, copper protein, cytochrome c oxidase assembly, Structural Proteomics in Europe, SPINE, Structural Genomics, METAL TRANSPORT
Deposited on 2004-03-13, released 2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome C oxidase assembly protein ctaG
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: CTAG, R00908, SMC00012
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1so9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1so9A (A:)
    mvplydmfcrvtgyngttqrveqasdlildekikvtfdanvaaglpwefvpvqrdidvri
    getvqimyraknlastpttgqatfnvtpmaagayfnkvqcfcftettlepgeemempvvf
    fvdpeivkpvetqgiktltlsytfyprepskpvaqvkakaenkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so9A (A:)
    veqasdlildekikvtfdanvaaglpwefvpvqrdidvrigetvqimyraknlastpttg
    qatfnvtpmaagayfnkvqcfcftettlepgeemempvvffvdpeivkpvetqgiktltl
    sytfyprepsk