PDB entry 1so7

View 1so7 on RCSB PDB site
Description: Maltose-induced structure of the human cytolsolic sialidase Neu2
Class: hydrolase
Keywords: sialidase, neuraminidase, ganglioside, sugar-induced form, hydrolase
Deposited on 2004-03-12, released 2004-11-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.202
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialidase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1so7a_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1so7A (A:)
    gsmaslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgd
    ydapthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtr
    anvtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpa
    yayrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnars
    hlrarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythp
    thswqradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeand
    yeeivflmftlkqafpaeylpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so7A (A:)
    lpvlqkesvfqsgahayripallylpgqqsllafaeqraelivlrrgdydapthqvqwqa
    qevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtranvtrlcqvtst
    dhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpayayrklhpiqrp
    ipsafcflshdhgrtwarghfvaqdtlecqvaevetqrvvtlnarshlrarvqaqstndg
    ldfqesqlvkklvepppqgcqgsvisfpsprspaqwllythpthswqradlgaylnprpp
    apeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmftlkqafpae
    y