PDB entry 1so4

View 1so4 on RCSB PDB site
Description: Crystal structure of K64A mutant of 3-keto-L-gulonate 6-phosphate decarboxylase with bound L-threonohydroxamate 4-phosphate
Class: lyase
Keywords: TIM Barrel; Beta Barrel, LYASE
Deposited on 2004-03-12, released 2004-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.164
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
    Species: Escherichia coli [TaxId:562]
    Gene: UlaD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39304
      • engineered (63)
    Domains in SCOPe 2.06: d1so4a_
  • Chain 'B':
    Compound: 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
    Species: Escherichia coli [TaxId:562]
    Gene: UlaD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39304 (Start-215)
      • engineered (63)
    Domains in SCOPe 2.06: d1so4b_
  • Heterogens: MG, TX4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1so4A (A:)
    mslpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivl
    adaaiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtwe
    qaqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplf
    kgipihvfiagrsirdaaspveaarqfkrsiaelwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so4A (A:)
    lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad
    aaiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweqa
    qqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfkg
    ipihvfiagrsirdaaspveaarqfkrsiaelw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1so4B (B:)
    mslpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivl
    adaaiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtwe
    qaqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplf
    kgipihvfiagrsirdaaspveaarqfkrsiaelwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so4B (B:)
    slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
    daaiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweq
    aqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfk
    gipihvfiagrsirdaaspveaarqfkrsiaelwg