PDB entry 1so3

View 1so3 on RCSB PDB site
Description: crystal structure of h136a mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate
Deposited on 2004-03-12, released 2004-06-08
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.15
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1so3a_
  • Chain 'B':
    Domains in SCOP 1.71: d1so3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1so3A (A:)
    mslpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivl
    adakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtwe
    qaqqwrdagigqvvyarsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplf
    kgipihvfiagrsirdaaspveaarqfkrsiaelwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so3A (A:)
    slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
    dakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweq
    aqqwrdagigqvvyarsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfk
    gipihvfiagrsirdaaspveaarqfkrsiaelw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1so3B (B:)
    mslpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivl
    adakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtwe
    qaqqwrdagigqvvyarsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplf
    kgipihvfiagrsirdaaspveaarqfkrsiaelwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so3B (B:)
    slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
    dakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweq
    aqqwrdagigqvvyarsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfk
    gipihvfiagrsirdaaspveaarqfkrsiaelwg