PDB entry 1so2

View 1so2 on RCSB PDB site
Description: catalytic domain of human phosphodiesterase 3b in complex with a dihydropyridazine inhibitor
Deposited on 2004-03-12, released 2004-05-11
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-11, with a file datestamp of 2004-05-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1so2a_
  • Chain 'B':
    Domains in SCOP 1.67: d1so2b_
  • Chain 'C':
    Domains in SCOP 1.67: d1so2c_
  • Chain 'D':
    Domains in SCOP 1.67: d1so2d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1so2A (A:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so2A (A:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihnggriayisskscs
    npdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenh
    haasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakandvn
    sngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpi
    spfmdrsspqlaklqesfithivgplcnsydaagllpgqwlesrrrifcqlmhhltenhk
    iwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1so2B (B:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so2B (B:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihnggriayisskscs
    npdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenh
    haasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakandvn
    sngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpi
    spfmdrsspqlaklqesfithivgplcnsydaagllpgqwlesrrrifcqlmhhltenhk
    iwk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1so2C (C:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so2C (C:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcdsdgrinhgri
    ayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavly
    ndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflae
    fnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgd
    eeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwlesrrrifcql
    mhhltenhkiwk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1so2D (D:)
    eqevsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleif
    kiptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnet
    dsdgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnafl
    vatnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailat
    dlkkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwte
    givnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqw
    leaeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1so2D (D:)
    ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
    qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngnhgriayissks
    csnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvle
    nhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakand
    vnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlgl
    pispfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaerrifcqlmhhlten
    hkiwk