PDB entry 1sny

View 1sny on RCSB PDB site
Description: Carbonyl reductase Sniffer of D. melanogaster
Class: oxidoreductase
Keywords: alpha and beta protein, Rossmann fold, dinucleotide binding motif, OXIDOREDUCTASE
Deposited on 2004-03-12, released 2004-09-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.247
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sniffer CG10964-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: sniffer
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9W3H4 (Start-266)
      • cloning artifact (19)
      • modified residue (20)
      • modified residue (139)
      • modified residue (160)
      • modified residue (170)
      • modified residue (185)
      • modified residue (212)
      • modified residue (225)
    Domains in SCOPe 2.05: d1snya_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1snyA (A:)
    mgsshhhhhhssglvprgshmnsilitgcnrglglglvkallnlpqppqhlfttcrnreq
    akeledlaknhsnihileidlrnfdaydklvadiegvtkdqglnvlfnnagiapksarit
    avrsqelldtlqtntvvpimlakaclpllkkaakanesqpmgvgraaiinmssilgsiqg
    ntdggmyayrtsksalnaatkslsvdlypqrimcvslhpgwvktdmggssapldvptstg
    qivqtisklgekqnggfvnydgtplaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1snyA (A:)
    hmnsilitgcnrglglglvkallnlpqppqhlfttcrnreqakeledlaknhsnihilei
    dlrnfdaydklvadiegvtkdqglnvlfnnagiapksaritavrsqelldtlqtntvvpi
    mlakaclpllkkaakanesqpmgvgraaiinmssilgsiqgntdggmyayrtsksalnaa
    tkslsvdlypqrimcvslhpgwvktdmggssapldvptstgqivqtisklgekqnggfvn
    ydgtplaw