PDB entry 1sny

View 1sny on RCSB PDB site
Description: Carbonyl reductase Sniffer of D. melanogaster
Deposited on 2004-03-12, released 2004-09-28
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.247
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1snya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1snyA (A:)
    mgsshhhhhhssglvprgshmnsilitgcnrglglglvkallnlpqppqhlfttcrnreq
    akeledlaknhsnihileidlrnfdaydklvadiegvtkdqglnvlfnnagiapksarit
    avrsqelldtlqtntvvpimlakaclpllkkaakanesqpmgvgraaiinmssilgsiqg
    ntdggmyayrtsksalnaatkslsvdlypqrimcvslhpgwvktdmggssapldvptstg
    qivqtisklgekqnggfvnydgtplaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1snyA (A:)
    hmnsilitgcnrglglglvkallnlpqppqhlfttcrnreqakeledlaknhsnihilei
    dlrnfdaydklvadiegvtkdqglnvlfnnagiapksaritavrsqelldtlqtntvvpi
    mlakaclpllkkaakanesqpmgvgraaiinmssilgsiqgntdggmyayrtsksalnaa
    tkslsvdlypqrimcvslhpgwvktdmggssapldvptstgqivqtisklgekqnggfvn
    ydgtplaw