PDB entry 1snu

View 1snu on RCSB PDB site
Description: crystal structure of the unphosphorylated interleukin-2 tyrosine kinase catalytic domain
Class: transferase
Keywords: protein kinase, immunology, transferase
Deposited on 2004-03-12, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ITK/TSK
    Species: Homo sapiens [TaxId:9606]
    Gene: ITK, LYK, EMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1snua_
  • Chain 'B':
    Compound: Tyrosine-protein kinase ITK/TSK
    Species: Homo sapiens [TaxId:9606]
    Gene: ITK, LYK, EMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1snub_
  • Heterogens: STU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1snuA (A:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
    sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
    erpedrpafsrllrqlaeiaesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1snuA (A:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfse
    gkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlae
    iaesg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1snuB (B:)
    vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
    klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
    cvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
    sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
    erpedrpafsrllrqlaeiaesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1snuB (B:)
    idpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshpk
    lvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeac
    vihrdlaarnclvgenqvikvsdfpvkwaspevfsfsryssksdvwsfgvlmwevfsegk
    ipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeia
    e